LL-37 5MG

Description

LL-37 5MG Lyophilized Peptide — Champion Peptides Research Grade

Get reliable data for your cellular biology and immunology research. Our high-quality LL-37 is synthesized and vacuum-sealed by Champion Peptides to ensure high purity and consistent performance in your lab.

High-Purity LL-37 5MG for Scientific Research

Molecular biology moves fast. Immunology and regenerative medicine require highly stable, pure compounds to get results you can publish with confidence. We offer LL-37 in a stable 5MG lyophilized format. This human cathelicidin-derived peptide plays a complex role in innate immunity, tissue repair, blood vessel growth, and inflammation control.

Buying from us means getting a product made to rigorous standards. We test every single batch. Each vial undergoes high-performance liquid chromatography (HPLC) and mass spectrometry (MS) to make sure the purity exceeds 98%. Maybe you are looking at how it interacts with bacterial cell walls. Maybe you are studying immune responses or tissue models. This LL-37 5MG formulation gives you the consistent structure your work requires.

Understanding LL-37: The Science of Human Cathelicidin

To get the most out of your experiments, it helps to understand how this biomolecule is put together. LL-37 is a 37-amino acid peptide. It starts with two leucine residues—that is where the name comes from. It represents the only amphipathic, alpha-helical peptide split from the C-terminus of the human cathelicidin antimicrobial peptide (CAMP) gene. Specifically, proteinase 3 in neutrophils cuts it from the precursor protein hCAP18.

In living organisms, many cells produce LL-37. This includes neutrophils, monocytes, mast cells, T-cells, and B-cells. You also find it in the epithelial cells of the lungs, gut, and urinary tract. Structurally, it has one side that hates water and another side with a strong electrical charge. This dual nature allows the peptide to bind directly with lipid bilayers—making it highly useful for studying membrane damage and defense systems.

It does more than just target microbes. LL-37 acts as a signaling molecule. It binds to multiple cell surface receptors—such as Formyl Peptide Receptor-Like 1 (FPRL1), purinergic receptor P2X7, and epidermal growth factor receptor (EGFR). These pathways let LL-37 influence cell movement, cytokine release, and gene expression. Because of this, it is a major focus in both innate and adaptive immunity studies.

Key Research Applications of LL-37

The versatile properties of LL-37 make it highly useful in several fields. Scientists who buy LL-37 online generally use it for several distinct types of experiments.

Antimicrobial and Membrane Disruption Studies

Researchers have long studied LL-37 for its ability to fight microbes. It shows clear inhibitory activity against Gram-negative and Gram-positive bacteria, along with some fungi and viruses. The peptide works by drawing itself to the negatively charged outer membranes of these pathogens. After binding, LL-37 sits on the surface before pushing its water-hating side into the lipid layer. This causes holes, thins the membrane, and eventually destroys the cell. Experiments using our LL-37 look closely at these physical interactions. They analyze how different lipid makeups alter insertion and whether the peptide can work alongside existing antibiotics to combat drug resistance.

Immunomodulation and Inflammatory Signaling

Its immune-regulating role is highly complex. The peptide acts in opposing ways depending on the environment. At times, it neutralizes lipopolysaccharide (LPS)—a bacterial toxin that triggers severe inflammation—preventing dangerous inflammatory chain reactions. At other times, it pulls immune cells toward an infection or injury site by acting as a chemoattractant for neutrophils, monocytes, and T-cells via FPRL1 receptor activation. Those studying autoimmune issues, chronic inflammation, and sepsis models use LL-37 to see how host-defense peptides balance protection against tissue damage.

Wound Healing, Angiogenesis, and Tissue Regeneration

Levels of LL-37 rise sharply when skin or tissue is damaged. Studies show it helps keratinocytes and blood vessel cells migrate and multiply. By working with the epidermal growth factor receptor (EGFR) and boosting vascular endothelial growth factor (VEGF), it supports angiogenesis—the growth of new blood vessels. Labs using our LL-37 5MG vials focus on scratch tests, tube assays, and animal models to see how well it speeds up healing and blood vessel formation in damaged tissues.

Why Quality and Purity Matter in Peptide Synthesis

When looking for LL-37 for sale, you have to be careful about the source. This is a long, 37-amino acid peptide with a tricky structure. Making it properly through solid-phase peptide synthesis (SPPS) requires real expertise. Poor synthesis or sloppy cleaning results in broken sequences, missing pieces, or leftover chemical solvents. Any of these issues can ruin your test results.

We use modern synthesis systems and multi-step cleaning methods. Every single run of our LL-37 undergoes strict testing:

• High-Performance Liquid Chromatography (HPLC): We use this to confirm that peptide purity is above 98%. This ensures no short sequences or chemical leftovers interfere with your binding studies.
• Mass Spectrometry (MS): This verifies the exact molecular weight and sequence of your LL-37, ensuring you get the correct 37-amino acid chain.
• Lyophilization (Freeze-Drying): A careful drying process that protects the peptide’s structure. This keeps it stable on the shelf and makes it dissolve quickly when you are ready to use it.

These strict standards mean that when you order from us, you get a reliable product that delivers consistent, clean data.

LL-37 5MG Product Specifications

To help you plan your experiments, here are the detailed chemical and physical specifications for our LL-37 peptide:

• Brand Name: Champion Peptides
• Product Name: LL-37
• Vial Size: 5MG (5 milligrams)
• Physical Form: Lyophilized white powder
• Purity: Greater than 98% (confirmed by HPLC)
• Molecular Formula: C105H149N31O29S
• Molecular Weight: 4493.3 g/mol
• Sequence: [LL-37, 37 aa]
• Source: Synthetic (Solid-phase peptide synthesis)
• Storage Conditions: Store at -20°C for long-term stability; avoid repeated freeze-thaw cycles.

Reconstitution and Handling Guidelines

How you handle and mix the peptide determines its activity. Because of how its structure interacts with water and fats, LL-37 can stick to plastic walls—especially hydrophobic plastics—or clump up if mixed incorrectly. Use these standard laboratory steps to keep your yield high:

Reconstitution Solvent Selection

The peptide dissolves well in sterile, deionized water or light acid solutions. For most assays, use sterile, preservative-free water or sterile phosphate-buffered saline (PBS). If you notice clumping at high concentrations, try using a mild acetic acid solution (0.1%). Adding a carrier protein like 0.1% Bovine Serum Albumin (BSA) also helps keep the peptide stable and stops it from sticking to vial walls.

Reconstitution Process

1. Let the vial reach room temperature before you open or mix it. This stops moisture from forming on the powder, which can damage the peptide.
2. Wipe the rubber top with an alcohol swab.
3. Use a sterile syringe to slowly add your liquid (for example, 1 mL of sterile water for a 5 mg/mL solution, or 2 mL for 2.5 mg/mL).
4. Point the liquid down the side of the glass rather than spraying it directly on the powder.
5. Swirl the vial gently until the powder dissolves fully. Avoid shaking it hard—this creates foam and can ruin the peptide’s structure.

Storage of Reconstituted LL-37

Once mixed, the liquid is far less stable than the dry powder. If you plan to use it soon, keep it at 2°C to 8°C for no more than 24 to 48 hours. For longer storage, divide the liquid into single-use portions and freeze them at -20°C or -80°C. This avoids damage from repeated freeze-thaw cycles, which can break down the peptide and ruin its performance.

Key Features and Benefits of Champion Peptides LL-37

• High Purity (>98%): Verified by HPLC and mass spectrometry. This keeps your experiments free of variables from broken peptide pieces or chemical residues.
• Practical 5MG Quantity: Provided in a versatile 5 milligram vial. This gives you enough material for in vitro testing, dose-response curves, or initial animal studies.
• Strong Structural Stability: Vacuum-lyophilized to ensure long shelf life. The peptide stays stable from shipping to reconstitution.
• Wide Research Use: A best resource for studying antibiotic resistance, immune signaling, wound healing, and vessel growth.
• Consistent Solubility: Prepared to dissolve cleanly in common laboratory liquids, reducing waste and keeping your work efficient.
• Secure Packaging: Sealed in medical-grade glass vials with tough rubber stoppers and flip-off tops to maintain clean conditions.

Where to Buy LL-37 Online Safely and Securely

When deciding where to buy LL-37, look for transparency and quality testing. The online market has plenty of suppliers selling low-grade peptides without proper analysis. We built our reputation on real scientific testing and reliable service.

We make buying LL-37 online simple. Our platform is secure and easy to use. Ordering from us means getting reliable, temperature-stable shipping and customer support for any technical questions. We know your lab timelines are tight—so we keep plenty of LL-37 5MG vials in stock to ship out quickly.

We offer competitive pricing to help you make the most of your research budget without sacrificing quality. If your institution needs larger amounts, we provide bulk options. Reach out to our team to talk about bulk orders and institutional pricing.

Frequently Asked Questions

What is the primary function of LL-37 in research?

Researchers use LL-37 to study the human innate immune system, bacterial membrane damage, immune pathways, and tissue repair. It works as a model compound for showing how host-defense peptides fight pathogens while managing inflammation and healing.

How should I store the LL-37 5MG vial upon receipt?

Once your shipment arrives, put the dry LL-37 5MG vial in a freezer at -20°C or lower. It can stay stable for several years this way. Keep the vial away from direct sunlight, dampness, or heat to prevent it from breaking down.

Can LL-37 be frozen after reconstitution?

Yes, but handle it with care. To avoid the damage of freezing and thawing it repeatedly, split the mixed solution into small, single-use portions. Store these at -20°C or -80°C. When running an assay, just thaw the single portion you need for that day.

What is the difference between LL-37 and other antimicrobial peptides?

LL-37 stands out because it is the only cathelicidin-derived peptide in humans. Many other antimicrobial peptides rely on beta-sheets. In contrast, LL-37 takes on a spiral, alpha-helical shape in physical environments. This structure gives it a unique mode of action—acting as a pathogen killer and a signaling ligand for animal cell receptors.

Is LL-37 suitable for in vivo research?

Yes, it is often used in animal models to study wound healing, blood vessel growth, and infections. You must calculate the correct dosage and delivery methods using peer-reviewed studies. Our LL-37 is sold purely for laboratory research and must not be used on humans.

Why is the LL-37 price highly variable across different suppliers?

Pricing depends on how the peptide is made and purified. Since LL-37 has a long, 37-amino acid chain, cheap manufacturing leads to impurities, partial sequences, and leftover solvents. High-quality LL-37 demands careful solid-phase synthesis, expensive purification, and analytical testing to pass the 98% purity mark. We balance clean quality with fair pricing to give you the best value.

How do I know I am getting the highest quality LL-37?

Every batch we sell comes with a Certificate of Analysis (COA) showing its HPLC and mass spectrometry data. We keep our quality control completely open so you know you are getting pure LL-37 for your work.

Choose Champion Peptides for Your Laboratory Needs

In scientific research, the quality of your compounds determines the reliability of your results. Avoid letting low-grade peptides threaten your work, time, and funding. Rely on Champion Peptides to supply the high-grade LL-37 5MG vials you need to advance your work in immunology and regenerative medicine. Order your LL-37 online today and see how our clean purity, careful testing, and supportive customer service can benefit your project.